| Sequence 1: | NP_608799.1 | Gene: | CG16713 / 33591 | FlyBaseID: | FBgn0031560 | Length: | 82 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_017951425.2 | Gene: | aplp2 / 100380132 | XenbaseID: | XB-GENE-5894468 | Length: | 753 | Species: | Xenopus tropicalis |
| Alignment Length: | 42 | Identity: | 21/42 - (50%) |
|---|---|---|---|
| Similarity: | 27/42 - (64%) | Gaps: | 0/42 - (0%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 39 CEAYIPSWSYDADRNECVKFIYGGCGGNNNRFNSREICEDKC 80 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG16713 | NP_608799.1 | Kunitz_SCI-I-like | 24..80 | CDD:438677 | 20/40 (50%) |
| aplp2 | XP_017951425.2 | A4_EXTRA | 31..195 | CDD:128326 | |
| Kunitz_ABPP-like | 293..344 | CDD:438650 | 20/40 (50%) | ||
| APP_E2 | 350..531 | CDD:463752 | |||
| JMTM_APLP2 | 670..750 | CDD:411992 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||