DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16713 and si:dkeyp-73b11.8

DIOPT Version :10

Sequence 1:NP_608799.1 Gene:CG16713 / 33591 FlyBaseID:FBgn0031560 Length:82 Species:Drosophila melanogaster
Sequence 2:NP_001373612.1 Gene:si:dkeyp-73b11.8 / 100333708 ZFINID:ZDB-GENE-131120-176 Length:230 Species:Danio rerio


Alignment Length:81 Identity:27/81 - (33%)
Similarity:37/81 - (45%) Gaps:8/81 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KLLILVFVFVAFVAN--ALALKNAICGLPHSLNGDGRISCEAYIPSWSYDADRNECVKFIYGGCG 64
            :|.|::|:| |...|  |...|...|.|.........:....|     ||||::.|..|.|.|.|
Zfish     3 ELGIILFIF-ALNHNIQAQTRKPEACTLKQDEGTGNDVVVYMY-----YDADKDSCYPFRYNGEG 61

  Fly    65 GNNNRFNSREICEDKC 80
            ||:|||.:.:.|...|
Zfish    62 GNSNRFITEKQCMRNC 77

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16713NP_608799.1 Kunitz_SCI-I-like 24..80 CDD:438677 18/55 (33%)
si:dkeyp-73b11.8NP_001373612.1 Kunitz_conkunitzin 27..77 CDD:438636 18/54 (33%)
Kunitz_BPTI 92..143 CDD:425421
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.