DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16713 and col28a2a

DIOPT Version :10

Sequence 1:NP_608799.1 Gene:CG16713 / 33591 FlyBaseID:FBgn0031560 Length:82 Species:Drosophila melanogaster
Sequence 2:NP_001153314.2 Gene:col28a2a / 100294690 ZFINID:ZDB-GENE-030131-4444 Length:1208 Species:Danio rerio


Alignment Length:44 Identity:20/44 - (45%)
Similarity:28/44 - (63%) Gaps:0/44 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 SCEAYIPSWSYDADRNECVKFIYGGCGGNNNRFNSREICEDKCL 81
            ||..|:..|.|:...|.|.:|.||||.||:|||::.|.|:..|:
Zfish  1160 SCRNYVIRWYYEKQSNSCAQFWYGGCDGNDNRFHTEEECKTTCV 1203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16713NP_608799.1 Kunitz_SCI-I-like 24..80 CDD:438677 19/41 (46%)
col28a2aNP_001153314.2 VWA 61..242 CDD:459670
gly_rich_SclB <260..>560 CDD:468478
gly_rich_SclB <511..>795 CDD:468478
VWA 816..995 CDD:459670
Kunitz_collagen_alpha1_XXVIII 1152..1202 CDD:438671 19/41 (46%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.