DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16713 and col28a2b

DIOPT Version :10

Sequence 1:NP_608799.1 Gene:CG16713 / 33591 FlyBaseID:FBgn0031560 Length:82 Species:Drosophila melanogaster
Sequence 2:XP_073809664.1 Gene:col28a2b / 100002791 ZFINID:ZDB-GENE-130530-762 Length:1195 Species:Danio rerio


Alignment Length:43 Identity:19/43 - (44%)
Similarity:24/43 - (55%) Gaps:0/43 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 CEAYIPSWSYDADRNECVKFIYGGCGGNNNRFNSREICEDKCL 81
            |..|...|.|....|.|.:|.||||.||.|||::.|.|:..|:
Zfish  1151 CREYNIRWYYVPQANACAQFWYGGCEGNRNRFDTEEECKKTCV 1193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16713NP_608799.1 Kunitz_SCI-I-like 24..80 CDD:438677 18/40 (45%)
col28a2bXP_073809664.1 None

Return to query results.
Submit another query.