DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3513 and Spint4

DIOPT Version :10

Sequence 1:NP_608798.1 Gene:CG3513 / 33590 FlyBaseID:FBgn0031559 Length:88 Species:Drosophila melanogaster
Sequence 2:NP_084334.1 Gene:Spint4 / 78239 MGIID:1925489 Length:159 Species:Mus musculus


Alignment Length:91 Identity:22/91 - (24%)
Similarity:36/91 - (39%) Gaps:14/91 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 IAFLLSLSGSRLWVHAKPE-----------MCQQPSSMVGMAQDGAACMAFMPAWTYDASKNACT 62
            :.|||.||   |.....|.           :|:..:....:..:..:|......:.|:.:...|.
Mouse     6 LGFLLGLS---LLCSLSPPVLSGVERLANYLCKDYNDPCLLDVEPGSCYEVHFRFFYNQTAKQCQ 67

  Fly    63 EFIFGGCGGNSNQFSTKSECEKACKD 88
            .|:|.||.||.|.|..|.:|:..|.:
Mouse    68 IFLFTGCNGNLNNFKLKIDCDVTCHE 93

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3513NP_608798.1 Kunitz_SCI-I-like 28..86 CDD:438677 14/57 (25%)
Spint4NP_084334.1 Kunitz-type 41..91 CDD:438633 13/49 (27%)

Return to query results.
Submit another query.