DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3513 and Wfdc8

DIOPT Version :10

Sequence 1:NP_608798.1 Gene:CG3513 / 33590 FlyBaseID:FBgn0031559 Length:88 Species:Drosophila melanogaster
Sequence 2:NP_001400645.1 Gene:Wfdc8 / 685170 RGDID:1597713 Length:272 Species:Rattus norvegicus


Alignment Length:68 Identity:25/68 - (36%)
Similarity:34/68 - (50%) Gaps:7/68 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 RLWVHAKPEMCQQPSSMVGMAQDGAACMAFMPAWTYDASKNACTEFIFGGCGGNSNQFSTKSECE 83
            ||.:....|.|..||       |...|...:..|.:|:.|:.|..|.:.|||||||.|.:|::|.
  Rat   111 RLCMDPYEEPCLLPS-------DAGNCKDTLTHWYFDSQKHKCRAFTYSGCGGNSNNFLSKADCR 168

  Fly    84 KAC 86
            .||
  Rat   169 NAC 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3513NP_608798.1 Kunitz_SCI-I-like 28..86 CDD:438677 20/57 (35%)
Wfdc8NP_001400645.1 WAP 73..116 CDD:459672 2/4 (50%)
Kunitz-type 121..171 CDD:438633 20/56 (36%)
WAP 176..216 CDD:459672
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.