DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3513 and Wfdc6b

DIOPT Version :10

Sequence 1:NP_608798.1 Gene:CG3513 / 33590 FlyBaseID:FBgn0031559 Length:88 Species:Drosophila melanogaster
Sequence 2:XP_006499938.1 Gene:Wfdc6b / 433502 MGIID:3575430 Length:155 Species:Mus musculus


Alignment Length:60 Identity:23/60 - (38%)
Similarity:32/60 - (53%) Gaps:7/60 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 EMCQQPSSMVGMAQDGAACMAFMPAWTYDASKNACTEFIFGGCGGNSNQFSTKSECEKAC 86
            ::|..|       ||...|:|::|.|.|:.....|.|||:|||.||.|.|.:|:.|...|
Mouse    93 DICSLP-------QDAGPCLAYLPRWWYNQDTKLCIEFIYGGCQGNPNNFESKAVCTSIC 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3513NP_608798.1 Kunitz_SCI-I-like 28..86 CDD:438677 22/57 (39%)
Wfdc6bXP_006499938.1 WAP <63..89 CDD:459672
Kunitz_eppin 93..149 CDD:438654 23/60 (38%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.