DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3513 and CG34276

DIOPT Version :10

Sequence 1:NP_608798.1 Gene:CG3513 / 33590 FlyBaseID:FBgn0031559 Length:88 Species:Drosophila melanogaster
Sequence 2:NP_001097810.1 Gene:CG34276 / 41934 FlyBaseID:FBgn0085305 Length:91 Species:Drosophila melanogaster


Alignment Length:80 Identity:23/80 - (28%)
Similarity:36/80 - (45%) Gaps:13/80 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VAIAFLLSLSGSRLWVHAKPEMCQQPSSMVGMAQDGAACMAFMPAWTYDASKNACTEFIFGGCGG 71
            :.:.|.|..|      ::....|.||.. ||..:      |::..|.|:::...|..|||.|...
  Fly    10 ILLVFCLQQS------YSIKRRCLQPLD-VGKGK------AYLRNWFYNSTSQRCQRFIFYGGAS 61

  Fly    72 NSNQFSTKSECEKAC 86
            |.|.|:|::.|.|.|
  Fly    62 NGNNFNTQARCHKIC 76

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3513NP_608798.1 Kunitz_SCI-I-like 28..86 CDD:438677 19/57 (33%)
CG34276NP_001097810.1 Kunitz_ixolaris_2 26..76 CDD:438669 19/56 (34%)

Return to query results.
Submit another query.