DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3513 and spint1a

DIOPT Version :10

Sequence 1:NP_608798.1 Gene:CG3513 / 33590 FlyBaseID:FBgn0031559 Length:88 Species:Drosophila melanogaster
Sequence 2:XP_073783238.1 Gene:spint1a / 406426 ZFINID:ZDB-GENE-040426-2169 Length:523 Species:Danio rerio


Alignment Length:42 Identity:18/42 - (42%)
Similarity:23/42 - (54%) Gaps:0/42 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 CMAFMPAWTYDASKNACTEFIFGGCGGNSNQFSTKSECEKAC 86
            |....|.|.|:|:...|.||.||||..|.|.:...:||:.||
Zfish   256 CRGSFPRWHYNAATEKCEEFKFGGCVPNRNNYLALNECQSAC 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3513NP_608798.1 Kunitz_SCI-I-like 28..86 CDD:438677 16/40 (40%)
spint1aXP_073783238.1 None

Return to query results.
Submit another query.