DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3513 and ambp

DIOPT Version :10

Sequence 1:NP_608798.1 Gene:CG3513 / 33590 FlyBaseID:FBgn0031559 Length:88 Species:Drosophila melanogaster
Sequence 2:NP_957412.2 Gene:ambp / 394093 ZFINID:ZDB-GENE-040426-1608 Length:346 Species:Danio rerio


Alignment Length:58 Identity:21/58 - (36%)
Similarity:30/58 - (51%) Gaps:7/58 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 CQQPSSMVGMAQDGAACMAFMPAWTYDASKNACTEFIFGGCGGNSNQFSTKSECEKAC 86
            |:.|       .|...|.||:..|.:|:|...|....:|||.||.|:|.:|.||::.|
Zfish   281 CRLP-------MDAGPCKAFVDLWAFDSSSGKCLSLKYGGCKGNGNRFYSKKECDEYC 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3513NP_608798.1 Kunitz_SCI-I-like 28..86 CDD:438677 20/56 (36%)
ambpNP_957412.2 lipocalin_A1M-like 24..186 CDD:381193
Kunitz_bikunin_1-like 223..276 CDD:438639
Kunitz_bikunin_2-like 278..332 CDD:438640 21/58 (36%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.