DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3513 and COL28A1

DIOPT Version :10

Sequence 1:NP_608798.1 Gene:CG3513 / 33590 FlyBaseID:FBgn0031559 Length:88 Species:Drosophila melanogaster
Sequence 2:NP_001032852.2 Gene:COL28A1 / 340267 HGNCID:22442 Length:1125 Species:Homo sapiens


Alignment Length:83 Identity:23/83 - (27%)
Similarity:35/83 - (42%) Gaps:17/83 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 WVHAKP-----EMCQQPSSMVGMAQDGAA------------CMAFMPAWTYDASKNACTEFIFGG 68
            |....|     |....|..::....|||.            |..::..|.||...|:|..|.|.|
Human  1040 WADDLPATTSSEATTTPRPLLSTPVDGAEDPRCLEALKPGNCGEYVVRWYYDKQVNSCARFWFSG 1104

  Fly    69 CGGNSNQFSTKSECEKAC 86
            |.|:.|:|:::.||::.|
Human  1105 CNGSGNRFNSEKECQETC 1122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3513NP_608798.1 Kunitz_SCI-I-like 28..86 CDD:438677 19/69 (28%)
COL28A1NP_001032852.2 vWFA_subfamily_ECM 47..209 CDD:238727
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 242..769
gly_rich_SclB <272..>582 CDD:468478
gly_rich_SclB <478..>759 CDD:468478
VWA 798..974 CDD:459670
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 999..1066 4/25 (16%)
Kunitz-type 1072..1122 CDD:444694 15/49 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.