DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3513 and Acp24A4

DIOPT Version :10

Sequence 1:NP_608798.1 Gene:CG3513 / 33590 FlyBaseID:FBgn0031559 Length:88 Species:Drosophila melanogaster
Sequence 2:NP_001036330.1 Gene:Acp24A4 / 318936 FlyBaseID:FBgn0051779 Length:78 Species:Drosophila melanogaster


Alignment Length:81 Identity:30/81 - (37%)
Similarity:41/81 - (50%) Gaps:14/81 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FVAIAFLLSLSGSRLWVHAKPEMCQQPSSMVGMAQDGAACMAFMPAWTYDASKNACTEFIFGGCG 70
            |:|:|     |.|   :..|.|:|..|::..|      .|:|....|:|||..|.|..||:|||.
  Fly    10 FIALA-----SNS---LALKNEICGLPAAANG------NCLALFSRWSYDAQYNVCFNFIYGGCQ 60

  Fly    71 GNSNQFSTKSECEKAC 86
            ||.|.|.::.||...|
  Fly    61 GNENSFESQEECINKC 76

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3513NP_608798.1 Kunitz_SCI-I-like 28..86 CDD:438677 22/57 (39%)
Acp24A4NP_001036330.1 Kunitz-type 25..76 CDD:438633 22/56 (39%)

Return to query results.
Submit another query.