| Sequence 1: | NP_608798.1 | Gene: | CG3513 / 33590 | FlyBaseID: | FBgn0031559 | Length: | 88 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001418648.1 | Gene: | Col28a1 / 312115 | RGDID: | 1564680 | Length: | 1141 | Species: | Rattus norvegicus |
| Alignment Length: | 42 | Identity: | 16/42 - (38%) |
|---|---|---|---|
| Similarity: | 25/42 - (59%) | Gaps: | 0/42 - (0%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 45 CMAFMPAWTYDASKNACTEFIFGGCGGNSNQFSTKSECEKAC 86 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG3513 | NP_608798.1 | Kunitz_SCI-I-like | 28..86 | CDD:438677 | 15/40 (38%) |
| Col28a1 | NP_001418648.1 | vWFA_subfamily_ECM | 47..212 | CDD:238727 | |
| gly_rich_SclB | <257..446 | CDD:468478 | |||
| gly_rich_SclB | <363..632 | CDD:468478 | |||
| Collagen | 713..772 | CDD:460189 | |||
| VWA | 798..974 | CDD:459670 | |||
| Kunitz-type | 1088..1138 | CDD:444694 | 15/40 (38%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||