DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3513 and Spint2

DIOPT Version :10

Sequence 1:NP_608798.1 Gene:CG3513 / 33590 FlyBaseID:FBgn0031559 Length:88 Species:Drosophila melanogaster
Sequence 2:NP_001076018.1 Gene:Spint2 / 292770 RGDID:735123 Length:250 Species:Rattus norvegicus


Alignment Length:60 Identity:23/60 - (38%)
Similarity:32/60 - (53%) Gaps:7/60 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 EMCQQPSSMVGMAQDGAACMAFMPAWTYDASKNACTEFIFGGCGGNSNQFSTKSECEKAC 86
            |.| .|.::.|      .|.|..|.|.||..||:|:.||:|||.||.|.:.::..|.:.|
  Rat   129 EYC-VPKAVTG------PCRAAFPRWYYDVEKNSCSSFIYGGCRGNKNSYLSQEACMQHC 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3513NP_608798.1 Kunitz_SCI-I-like 28..86 CDD:438677 21/57 (37%)
Spint2NP_001076018.1 Kunitz_HAI2_1-like 36..88 CDD:438664
Kunitz_HAI2_2-like 129..181 CDD:438665 22/58 (38%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.