DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3513 and Tfpi2

DIOPT Version :10

Sequence 1:NP_608798.1 Gene:CG3513 / 33590 FlyBaseID:FBgn0031559 Length:88 Species:Drosophila melanogaster
Sequence 2:NP_775164.2 Gene:Tfpi2 / 286926 RGDID:628629 Length:230 Species:Rattus norvegicus


Alignment Length:74 Identity:24/74 - (32%)
Similarity:34/74 - (45%) Gaps:13/74 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LSLSGSRLWVHAKPEMCQQPSSMVGMAQDGAACMAFMPAWTYDASKNACTEFIFGGCGGNSNQFS 77
            :|..|:.|      |:|..|..|       ..|.|.:|.:.||..:..|..|.:|||.||:|.|.
  Rat    26 VSAQGNNL------EICLLPLDM-------GPCKALIPKFYYDRDQKKCRRFKYGGCLGNANNFH 77

  Fly    78 TKSECEKAC 86
            ::..||..|
  Rat    78 SRKLCEHTC 86

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3513NP_608798.1 Kunitz_SCI-I-like 28..86 CDD:438677 19/57 (33%)
Tfpi2NP_775164.2 Kunitz-type 32..87 CDD:444694 22/68 (32%)
Kunitz-type 93..146 CDD:444694
Kunitz_TFPI1_TFPI2_3-like 153..206 CDD:438658
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.