| Sequence 1: | NP_608798.1 | Gene: | CG3513 / 33590 | FlyBaseID: | FBgn0031559 | Length: | 88 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001624.1 | Gene: | AMBP / 259 | HGNCID: | 453 | Length: | 352 | Species: | Homo sapiens |
| Alignment Length: | 42 | Identity: | 19/42 - (45%) |
|---|---|---|---|
| Similarity: | 26/42 - (61%) | Gaps: | 0/42 - (0%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 45 CMAFMPAWTYDASKNACTEFIFGGCGGNSNQFSTKSECEKAC 86 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG3513 | NP_608798.1 | Kunitz_SCI-I-like | 28..86 | CDD:438677 | 18/40 (45%) |
| AMBP | NP_001624.1 | lipocalin_A1M-like | 28..190 | CDD:381193 | |
| Glycopeptide (secretory piece) | 206..226 | ||||
| Kunitz_bikunin_1-like | 229..282 | CDD:438639 | |||
| Kunitz_bikunin_2-like | 284..338 | CDD:438640 | 19/42 (45%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||