DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3513 and AMBP

DIOPT Version :10

Sequence 1:NP_608798.1 Gene:CG3513 / 33590 FlyBaseID:FBgn0031559 Length:88 Species:Drosophila melanogaster
Sequence 2:NP_001624.1 Gene:AMBP / 259 HGNCID:453 Length:352 Species:Homo sapiens


Alignment Length:42 Identity:19/42 - (45%)
Similarity:26/42 - (61%) Gaps:0/42 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 CMAFMPAWTYDASKNACTEFIFGGCGGNSNQFSTKSECEKAC 86
            |.||:..|.:||.|..|..|.:|||.||.|:|.::.||.:.|
Human   296 CRAFIQLWAFDAVKGKCVLFPYGGCQGNGNKFYSEKECREYC 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3513NP_608798.1 Kunitz_SCI-I-like 28..86 CDD:438677 18/40 (45%)
AMBPNP_001624.1 lipocalin_A1M-like 28..190 CDD:381193
Glycopeptide (secretory piece) 206..226
Kunitz_bikunin_1-like 229..282 CDD:438639
Kunitz_bikunin_2-like 284..338 CDD:438640 19/42 (45%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.