DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3513 and Ambp

DIOPT Version :10

Sequence 1:NP_608798.1 Gene:CG3513 / 33590 FlyBaseID:FBgn0031559 Length:88 Species:Drosophila melanogaster
Sequence 2:NP_001416262.1 Gene:Ambp / 25377 RGDID:2102 Length:361 Species:Rattus norvegicus


Alignment Length:42 Identity:19/42 - (45%)
Similarity:29/42 - (69%) Gaps:0/42 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 CMAFMPAWTYDASKNACTEFIFGGCGGNSNQFSTKSECEKAC 86
            |.||...|.:||::..|.:||:|||.||.|:|.::.||::.|
  Rat   295 CRAFAELWAFDAAQGKCIQFIYGGCKGNGNKFYSEKECKEYC 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3513NP_608798.1 Kunitz_SCI-I-like 28..86 CDD:438677 18/40 (45%)
AmbpNP_001416262.1 None

Return to query results.
Submit another query.