DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3513 and ZK287.4

DIOPT Version :10

Sequence 1:NP_608798.1 Gene:CG3513 / 33590 FlyBaseID:FBgn0031559 Length:88 Species:Drosophila melanogaster
Sequence 2:NP_001256133.1 Gene:ZK287.4 / 191282 WormBaseID:WBGene00013965 Length:1285 Species:Caenorhabditis elegans


Alignment Length:66 Identity:22/66 - (33%)
Similarity:33/66 - (50%) Gaps:11/66 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 HAKPEMCQQPSSM-VGMAQDGAACMAFMPAWTYDASKNACTEFIFGGCGGNSNQFSTKSECEKAC 86
            ||...:|.||..: .|:..:        ..|.|.|.:  ||.|::.|.|||.|.|.|:::|.|.|
 Worm   989 HASNNLCGQPIDVGFGVLSE--------HRWAYSAGQ--CTSFLYSGHGGNMNNFLTRNDCMKTC 1043

  Fly    87 K 87
            :
 Worm  1044 Q 1044

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3513NP_608798.1 Kunitz_SCI-I-like 28..86 CDD:438677 19/58 (33%)
ZK287.4NP_001256133.1 Lustrin_cystein 45..91 CDD:464222
Kunitz_BPTI 99..151 CDD:425421
Kunitz_conkunitzin 257..308 CDD:438636
KU 318..368 CDD:197529
Kunitz_conkunitzin 846..896 CDD:438636
Kunitz_conkunitzin 995..1043 CDD:438636 19/57 (33%)
Kunitz_conkunitzin 1054..1104 CDD:438636
Lustrin_cystein 1148..1189 CDD:464222
KU <1215..1259 CDD:197529
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.