DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3513 and K01C8.2

DIOPT Version :10

Sequence 1:NP_608798.1 Gene:CG3513 / 33590 FlyBaseID:FBgn0031559 Length:88 Species:Drosophila melanogaster
Sequence 2:NP_495742.1 Gene:K01C8.2 / 186839 WormBaseID:WBGene00010457 Length:389 Species:Caenorhabditis elegans


Alignment Length:58 Identity:16/58 - (27%)
Similarity:24/58 - (41%) Gaps:2/58 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 CQQPSSMVGMAQDGAACMAFMPAWTYDASKNACTEFIFG-GCGGNSNQFSTKSECEKA 85
            |.|||.:..:..:.|........:. :.|:|..|..|.| .|..:||..||...|..:
 Worm    70 CSQPSGVTPICPNNAVSQPSTIGYV-ECSQNNPTNCITGYQCVQSSNVASTFLCCSSS 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3513NP_608798.1 Kunitz_SCI-I-like 28..86 CDD:438677 16/58 (28%)
K01C8.2NP_495742.1 Lustrin_cystein 137..174 CDD:464222
Lustrin_cystein 235..280 CDD:464222
Lustrin_cystein 292..337 CDD:464222
Lustrin_cystein 345..387 CDD:464222
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.