DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3513 and C10G8.2

DIOPT Version :10

Sequence 1:NP_608798.1 Gene:CG3513 / 33590 FlyBaseID:FBgn0031559 Length:88 Species:Drosophila melanogaster
Sequence 2:NP_504418.1 Gene:C10G8.2 / 182501 WormBaseID:WBGene00015681 Length:208 Species:Caenorhabditis elegans


Alignment Length:33 Identity:11/33 - (33%)
Similarity:15/33 - (45%) Gaps:0/33 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 YDASKNACTEFIFGGCGGNSNQFSTKSECEKAC 86
            :|.|...|..|.:.||....|:|.:..||...|
 Worm    46 FDQSTGLCMNFRWDGCKDQENKFDSLQECASTC 78

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3513NP_608798.1 Kunitz_SCI-I-like 28..86 CDD:438677 10/31 (32%)
C10G8.2NP_504418.1 Kunitz_BPTI <38..78 CDD:425421 10/31 (32%)

Return to query results.
Submit another query.