DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3513 and E01G6.1

DIOPT Version :10

Sequence 1:NP_608798.1 Gene:CG3513 / 33590 FlyBaseID:FBgn0031559 Length:88 Species:Drosophila melanogaster
Sequence 2:NP_510044.2 Gene:E01G6.1 / 181387 WormBaseID:WBGene00008449 Length:1467 Species:Caenorhabditis elegans


Alignment Length:35 Identity:17/35 - (48%)
Similarity:25/35 - (71%) Gaps:0/35 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 WTYDASKNACTEFIFGGCGGNSNQFSTKSECEKAC 86
            |.||.||..|::|::.||||..|:|:||..|.::|
 Worm   561 WFYDKSKKKCSQFVYNGCGGTPNRFTTKVACTESC 595

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3513NP_608798.1 Kunitz_SCI-I-like 28..86 CDD:438677 16/33 (48%)
E01G6.1NP_510044.2 WR1 289..325 CDD:214601
Kunitz_BPTI 330..386 CDD:425421
Kunitz_BPTI 437..492 CDD:425421
Kunitz_BPTI 541..596 CDD:425421 17/35 (49%)
Lustrin_cystein 604..648 CDD:464222
Lustrin_cystein 859..902 CDD:464222
Lustrin_cystein 909..951 CDD:464222
Lustrin_cystein 1197..1239 CDD:464222
EB 1265..1321 CDD:460294
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.