| Sequence 1: | NP_608798.1 | Gene: | CG3513 / 33590 | FlyBaseID: | FBgn0031559 | Length: | 88 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_505684.2 | Gene: | F22E12.1 / 179460 | WormBaseID: | WBGene00009058 | Length: | 763 | Species: | Caenorhabditis elegans |
| Alignment Length: | 47 | Identity: | 18/47 - (38%) |
|---|---|---|---|
| Similarity: | 23/47 - (48%) | Gaps: | 1/47 - (2%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 41 DGAAC-MAFMPAWTYDASKNACTEFIFGGCGGNSNQFSTKSECEKAC 86 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG3513 | NP_608798.1 | Kunitz_SCI-I-like | 28..86 | CDD:438677 | 17/45 (38%) |
| F22E12.1 | NP_505684.2 | Kunitz-type | 25..76 | CDD:438633 | 17/45 (38%) |
| KU | 85..137 | CDD:197529 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||