DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3513 and F22E12.1

DIOPT Version :10

Sequence 1:NP_608798.1 Gene:CG3513 / 33590 FlyBaseID:FBgn0031559 Length:88 Species:Drosophila melanogaster
Sequence 2:NP_505684.2 Gene:F22E12.1 / 179460 WormBaseID:WBGene00009058 Length:763 Species:Caenorhabditis elegans


Alignment Length:47 Identity:18/47 - (38%)
Similarity:23/47 - (48%) Gaps:1/47 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 DGAAC-MAFMPAWTYDASKNACTEFIFGGCGGNSNQFSTKSECEKAC 86
            |...| :.|...|.||...:.|..|.:|||.||.|:|.:..||...|
 Worm    30 DRGTCELDFHVKWYYDRYDHRCRRFFYGGCEGNENRFDSLEECSSQC 76

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3513NP_608798.1 Kunitz_SCI-I-like 28..86 CDD:438677 17/45 (38%)
F22E12.1NP_505684.2 Kunitz-type 25..76 CDD:438633 17/45 (38%)
KU 85..137 CDD:197529
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.