DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3513 and Y57A10A.24

DIOPT Version :10

Sequence 1:NP_608798.1 Gene:CG3513 / 33590 FlyBaseID:FBgn0031559 Length:88 Species:Drosophila melanogaster
Sequence 2:NP_001370094.1 Gene:Y57A10A.24 / 174864 WormBaseID:WBGene00013264 Length:520 Species:Caenorhabditis elegans


Alignment Length:76 Identity:21/76 - (27%)
Similarity:30/76 - (39%) Gaps:7/76 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LSLSGSRLWVHAKPEMCQQPSSMVGMAQDGAACMAFMPAWTYDA-SKNACTEFIFGGCGGNSNQF 76
            |.||.|..:...|| |.:..||::........|....|...:|. |...|.:.:.|.|.    :|
 Worm   136 LKLSKSAPFPKEKP-MQKSTSSLMTSLDSSQICPKSHPIIAHDGKSLVLCKDCVQGVCA----KF 195

  Fly    77 STKSECEKACK 87
            .| |..|..|:
 Worm   196 RT-SNVEVCCQ 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3513NP_608798.1 Kunitz_SCI-I-like 28..86 CDD:438677 14/58 (24%)
Y57A10A.24NP_001370094.1 Lustrin_cystein 470..513 CDD:464222
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.