DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3513 and axo

DIOPT Version :10

Sequence 1:NP_608798.1 Gene:CG3513 / 33590 FlyBaseID:FBgn0031559 Length:88 Species:Drosophila melanogaster
Sequence 2:XP_061506652.1 Gene:axo / 1277107 VectorBaseID:AGAMI1_007650 Length:2097 Species:Anopheles gambiae


Alignment Length:71 Identity:25/71 - (35%)
Similarity:36/71 - (50%) Gaps:7/71 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 VHAKPEMCQQPSSMV-----GMAQDGAACMAFMPAWTYDASKNACTEFIFGGCGGN-SNQFSTKS 80
            |.|.|...:.|..:|     |..:.| .|..|...:.::.:.|.||:||:|||||| .|.|.|..
Mosquito    25 VLAIPTNAEPPKEIVYPKCTGPGEPG-QCQTFDYRYRFEQTINNCTQFIWGGCGGNLQNNFETYE 88

  Fly    81 ECEKAC 86
            :|.:.|
Mosquito    89 QCMQQC 94

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3513NP_608798.1 Kunitz_SCI-I-like 28..86 CDD:438677 21/63 (33%)
axoXP_061506652.1 None

Return to query results.
Submit another query.