| Sequence 1: | NP_608798.1 | Gene: | CG3513 / 33590 | FlyBaseID: | FBgn0031559 | Length: | 88 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_031469.1 | Gene: | Ambp / 11699 | MGIID: | 88002 | Length: | 349 | Species: | Mus musculus |
| Alignment Length: | 42 | Identity: | 18/42 - (42%) |
|---|---|---|---|
| Similarity: | 29/42 - (69%) | Gaps: | 0/42 - (0%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 45 CMAFMPAWTYDASKNACTEFIFGGCGGNSNQFSTKSECEKAC 86 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG3513 | NP_608798.1 | Kunitz_SCI-I-like | 28..86 | CDD:438677 | 17/40 (43%) |
| Ambp | NP_031469.1 | lipocalin_A1M-like | 27..189 | CDD:381193 | |
| Kunitz_bikunin_1-like | 228..281 | CDD:438639 | |||
| Kunitz_bikunin_2-like | 284..337 | CDD:438640 | 18/42 (43%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||