DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3513 and Ambp

DIOPT Version :10

Sequence 1:NP_608798.1 Gene:CG3513 / 33590 FlyBaseID:FBgn0031559 Length:88 Species:Drosophila melanogaster
Sequence 2:NP_031469.1 Gene:Ambp / 11699 MGIID:88002 Length:349 Species:Mus musculus


Alignment Length:42 Identity:18/42 - (42%)
Similarity:29/42 - (69%) Gaps:0/42 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 CMAFMPAWTYDASKNACTEFIFGGCGGNSNQFSTKSECEKAC 86
            |.||:..|.:||::..|.:|.:|||.||.|:|.::.||::.|
Mouse   295 CRAFIKLWAFDAAQGKCIQFHYGGCKGNGNKFYSEKECKEYC 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3513NP_608798.1 Kunitz_SCI-I-like 28..86 CDD:438677 17/40 (43%)
AmbpNP_031469.1 lipocalin_A1M-like 27..189 CDD:381193
Kunitz_bikunin_1-like 228..281 CDD:438639
Kunitz_bikunin_2-like 284..337 CDD:438640 18/42 (43%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.