DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16704 and Spint4

DIOPT Version :10

Sequence 1:NP_608797.1 Gene:CG16704 / 33589 FlyBaseID:FBgn0031558 Length:79 Species:Drosophila melanogaster
Sequence 2:NP_084334.1 Gene:Spint4 / 78239 MGIID:1925489 Length:159 Species:Mus musculus


Alignment Length:85 Identity:23/85 - (27%)
Similarity:41/85 - (48%) Gaps:11/85 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 YLVVFALICCL---VASAFATLKNPICGEEFG-------VKGTCRSLQPMWTYRPDTNECFTFNY 57
            :|:..:|:|.|   |.|....|.|.:| :::.       ..|:|..:...:.|.....:|..|.:
Mouse     8 FLLGLSLLCSLSPPVLSGVERLANYLC-KDYNDPCLLDVEPGSCYEVHFRFFYNQTAKQCQIFLF 71

  Fly    58 SGCHGNNNLFHKKLECEEKC 77
            :||:||.|.|..|::|:..|
Mouse    72 TGCNGNLNNFKLKIDCDVTC 91

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16704NP_608797.1 Kunitz-type 32..77 CDD:444694 13/44 (30%)
Spint4NP_084334.1 Kunitz-type 41..91 CDD:438633 13/49 (27%)

Return to query results.
Submit another query.