DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16704 and Eppin

DIOPT Version :10

Sequence 1:NP_608797.1 Gene:CG16704 / 33589 FlyBaseID:FBgn0031558 Length:79 Species:Drosophila melanogaster
Sequence 2:NP_083601.1 Gene:Eppin / 75526 MGIID:1922776 Length:134 Species:Mus musculus


Alignment Length:71 Identity:22/71 - (30%)
Similarity:30/71 - (42%) Gaps:5/71 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 CCLVASAFATLKNP---ICGEEFGVKGTCRSLQPMWTYRPDTNECFTFNYSGCHGNNNLFHKKLE 72
            ||:.......| ||   ||..... .|.|.:....|.:..:.:.|..|.|.||.||||.|..:..
Mouse    60 CCVFNCGKKCL-NPQQDICSLPKD-SGYCMAYFRRWWFNKENSTCQVFIYGGCQGNNNNFQSQSI 122

  Fly    73 CEEKCK 78
            |:..|:
Mouse   123 CQNACE 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16704NP_608797.1 Kunitz-type 32..77 CDD:444694 14/44 (32%)
EppinNP_083601.1 WAP 30..72 CDD:459672 3/12 (25%)
Kunitz_eppin 75..131 CDD:438654 17/55 (31%)
Interaction with SEMG1. /evidence=ECO:0000250 102..133 12/27 (44%)
Interaction with LTF. /evidence=ECO:0000250 117..133 3/12 (25%)

Return to query results.
Submit another query.