DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16704 and TFPI

DIOPT Version :10

Sequence 1:NP_608797.1 Gene:CG16704 / 33589 FlyBaseID:FBgn0031558 Length:79 Species:Drosophila melanogaster
Sequence 2:NP_006278.1 Gene:TFPI / 7035 HGNCID:11760 Length:304 Species:Homo sapiens


Alignment Length:46 Identity:19/46 - (41%)
Similarity:24/46 - (52%) Gaps:0/46 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 KGTCRSLQPMWTYRPDTNECFTFNYSGCHGNNNLFHKKLECEEKCK 78
            :|.||:.:..:.|.....:|..|.||||.||.|.|..|.||...||
Human   223 RGLCRANENRFYYNSVIGKCRPFKYSGCGGNENNFTSKQECLRACK 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16704NP_608797.1 Kunitz-type 32..77 CDD:444694 17/43 (40%)
TFPINP_006278.1 Kunitz_TFPI1_1-like 51..105 CDD:438656
Kunitz_TFPI1_2-like 121..176 CDD:438657
Kunitz_TFPI1_TFPI2_3-like 214..267 CDD:438658 17/43 (40%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.