| Sequence 1: | NP_608797.1 | Gene: | CG16704 / 33589 | FlyBaseID: | FBgn0031558 | Length: | 79 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001400645.1 | Gene: | Wfdc8 / 685170 | RGDID: | 1597713 | Length: | 272 | Species: | Rattus norvegicus |
| Alignment Length: | 44 | Identity: | 16/44 - (36%) |
|---|---|---|---|
| Similarity: | 22/44 - (50%) | Gaps: | 0/44 - (0%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 34 GTCRSLQPMWTYRPDTNECFTFNYSGCHGNNNLFHKKLECEEKC 77 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG16704 | NP_608797.1 | Kunitz-type | 32..77 | CDD:444694 | 15/42 (36%) |
| Wfdc8 | NP_001400645.1 | WAP | 73..116 | CDD:459672 | |
| Kunitz-type | 121..171 | CDD:438633 | 15/42 (36%) | ||
| WAP | 176..216 | CDD:459672 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||