DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16704 and Wfdc8

DIOPT Version :10

Sequence 1:NP_608797.1 Gene:CG16704 / 33589 FlyBaseID:FBgn0031558 Length:79 Species:Drosophila melanogaster
Sequence 2:NP_001400645.1 Gene:Wfdc8 / 685170 RGDID:1597713 Length:272 Species:Rattus norvegicus


Alignment Length:44 Identity:16/44 - (36%)
Similarity:22/44 - (50%) Gaps:0/44 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 GTCRSLQPMWTYRPDTNECFTFNYSGCHGNNNLFHKKLECEEKC 77
            |.|:.....|.:....::|..|.||||.||:|.|..|.:|...|
  Rat   128 GNCKDTLTHWYFDSQKHKCRAFTYSGCGGNSNNFLSKADCRNAC 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16704NP_608797.1 Kunitz-type 32..77 CDD:444694 15/42 (36%)
Wfdc8NP_001400645.1 WAP 73..116 CDD:459672
Kunitz-type 121..171 CDD:438633 15/42 (36%)
WAP 176..216 CDD:459672
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.