DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16704 and Spint3

DIOPT Version :10

Sequence 1:NP_608797.1 Gene:CG16704 / 33589 FlyBaseID:FBgn0031558 Length:79 Species:Drosophila melanogaster
Sequence 2:NP_001386496.1 Gene:Spint3 / 685136 RGDID:1597746 Length:87 Species:Rattus norvegicus


Alignment Length:45 Identity:18/45 - (40%)
Similarity:25/45 - (55%) Gaps:0/45 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 KGTCRSLQPMWTYRPDTNECFTFNYSGCHGNNNLFHKKLECEEKC 77
            ||.||::...|.|...|.:|..|:|.||.||.|.|..:.:|:..|
  Rat    40 KGECRAIFVRWYYDTKTKKCDWFHYGGCRGNENNFLSRNQCQTVC 84

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16704NP_608797.1 Kunitz-type 32..77 CDD:444694 17/43 (40%)
Spint3NP_001386496.1 Kunitz-type 30..84 CDD:444694 17/43 (40%)

Return to query results.
Submit another query.