DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16704 and tfpi2

DIOPT Version :10

Sequence 1:NP_608797.1 Gene:CG16704 / 33589 FlyBaseID:FBgn0031558 Length:79 Species:Drosophila melanogaster
Sequence 2:NP_001015766.1 Gene:tfpi2 / 548483 XenbaseID:XB-GENE-1002090 Length:219 Species:Xenopus tropicalis


Alignment Length:45 Identity:17/45 - (37%)
Similarity:23/45 - (51%) Gaps:0/45 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 KGTCRSLQPMWTYRPDTNECFTFNYSGCHGNNNLFHKKLECEEKC 77
            :|.||.....:.|...|.:|..|.|.||:||:|.|..|..|.:.|
 Frog    95 EGPCRGFLKRYAYNMQTMKCEQFYYGGCYGNDNNFKDKASCMDFC 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16704NP_608797.1 Kunitz-type 32..77 CDD:444694 16/43 (37%)
tfpi2NP_001015766.1 Kunitz_TFPI2_1-like 25..81 CDD:438659
Kunitz_TFPI2_2-like 86..139 CDD:438660 16/43 (37%)
Kunitz_TFPI1_TFPI2_3-like 146..199 CDD:438658
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.