| Sequence 1: | NP_608797.1 | Gene: | CG16704 / 33589 | FlyBaseID: | FBgn0031558 | Length: | 79 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001015766.1 | Gene: | tfpi2 / 548483 | XenbaseID: | XB-GENE-1002090 | Length: | 219 | Species: | Xenopus tropicalis |
| Alignment Length: | 45 | Identity: | 17/45 - (37%) |
|---|---|---|---|
| Similarity: | 23/45 - (51%) | Gaps: | 0/45 - (0%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 33 KGTCRSLQPMWTYRPDTNECFTFNYSGCHGNNNLFHKKLECEEKC 77 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG16704 | NP_608797.1 | Kunitz-type | 32..77 | CDD:444694 | 16/43 (37%) |
| tfpi2 | NP_001015766.1 | Kunitz_TFPI2_1-like | 25..81 | CDD:438659 | |
| Kunitz_TFPI2_2-like | 86..139 | CDD:438660 | 16/43 (37%) | ||
| Kunitz_TFPI1_TFPI2_3-like | 146..199 | CDD:438658 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||