DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16704 and axo

DIOPT Version :10

Sequence 1:NP_608797.1 Gene:CG16704 / 33589 FlyBaseID:FBgn0031558 Length:79 Species:Drosophila melanogaster
Sequence 2:NP_001246631.1 Gene:axo / 43923 FlyBaseID:FBgn0262870 Length:2179 Species:Drosophila melanogaster


Alignment Length:48 Identity:20/48 - (41%)
Similarity:23/48 - (47%) Gaps:1/48 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 GVKGTCRSLQPMWTYRPDTNECFTFNYSGCHGN-NNLFHKKLECEEKC 77
            |..|.|:.....|.|.|.||||..|.:.||.|| .|.|..:.||...|
  Fly   123 GDPGPCKQYIYKWRYEPTTNECTNFIWGGCEGNPQNRFGTEAECLFHC 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16704NP_608797.1 Kunitz-type 32..77 CDD:444694 18/45 (40%)
axoNP_001246631.1 Kunitz-type 119..170 CDD:438633 19/46 (41%)
Laminin_G_2 275..413 CDD:460494
EGF_CA 433..476 CDD:238011
Laminin_G_2 514..640 CDD:460494
Laminin_G_2 698..817 CDD:460494
EGF_CA 842..878 CDD:238011
Laminin_G_2 1112..1240 CDD:460494
EGF_CA 1256..1297 CDD:238011
Laminin_G_2 1351..1503 CDD:460494
Laminin_G_2 1612..1733 CDD:460494
PHA03247 <1895..2164 CDD:223021
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.