DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16704 and CG42827

DIOPT Version :10

Sequence 1:NP_608797.1 Gene:CG16704 / 33589 FlyBaseID:FBgn0031558 Length:79 Species:Drosophila melanogaster
Sequence 2:NP_651142.3 Gene:CG42827 / 42763 FlyBaseID:FBgn0262009 Length:116 Species:Drosophila melanogaster


Alignment Length:87 Identity:25/87 - (28%)
Similarity:39/87 - (44%) Gaps:18/87 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LIC--CLVASAFA------TLKNPICGEEFGVK----------GTCRSLQPMWTYRPDTNECFTF 55
            ::|  ||.....|      :|:.....|::.::          |.|:..:.:|.|.|..::|..|
  Fly     5 ILCIFCLATVILAIDMDSDSLQEQYEREQYNIRKKICLQSSEYGKCKGRRKLWFYNPKKSKCQVF 69

  Fly    56 NYSGCHGNNNLFHKKLECEEKC 77
            .||.|.||.|||:.|..|.|.|
  Fly    70 IYSNCGGNGNLFYTKESCVEFC 91

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16704NP_608797.1 Kunitz-type 32..77 CDD:444694 18/54 (33%)
CG42827NP_651142.3 Kunitz-type 41..91 CDD:438633 18/49 (37%)

Return to query results.
Submit another query.