DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16704 and spint1a

DIOPT Version :10

Sequence 1:NP_608797.1 Gene:CG16704 / 33589 FlyBaseID:FBgn0031558 Length:79 Species:Drosophila melanogaster
Sequence 2:XP_073783238.1 Gene:spint1a / 406426 ZFINID:ZDB-GENE-040426-2169 Length:523 Species:Danio rerio


Alignment Length:46 Identity:20/46 - (43%)
Similarity:23/46 - (50%) Gaps:0/46 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 VKGTCRSLQPMWTYRPDTNECFTFNYSGCHGNNNLFHKKLECEEKC 77
            |.|||...|..|.|.|:...|:.|||.||.||.|.|..:..|...|
Zfish   390 VTGTCPGSQTKWYYNPNKRLCYRFNYGGCEGNQNRFETEAGCMTFC 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16704NP_608797.1 Kunitz-type 32..77 CDD:444694 19/44 (43%)
spint1aXP_073783238.1 None

Return to query results.
Submit another query.