| Sequence 1: | NP_608797.1 | Gene: | CG16704 / 33589 | FlyBaseID: | FBgn0031558 | Length: | 79 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_957412.2 | Gene: | ambp / 394093 | ZFINID: | ZDB-GENE-040426-1608 | Length: | 346 | Species: | Danio rerio |
| Alignment Length: | 44 | Identity: | 16/44 - (36%) |
|---|---|---|---|
| Similarity: | 25/44 - (56%) | Gaps: | 0/44 - (0%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 34 GTCRSLQPMWTYRPDTNECFTFNYSGCHGNNNLFHKKLECEEKC 77 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG16704 | NP_608797.1 | Kunitz-type | 32..77 | CDD:444694 | 15/42 (36%) |
| ambp | NP_957412.2 | lipocalin_A1M-like | 24..186 | CDD:381193 | |
| Kunitz_bikunin_1-like | 223..276 | CDD:438639 | |||
| Kunitz_bikunin_2-like | 278..332 | CDD:438640 | 16/44 (36%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||