DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16704 and ambp

DIOPT Version :10

Sequence 1:NP_608797.1 Gene:CG16704 / 33589 FlyBaseID:FBgn0031558 Length:79 Species:Drosophila melanogaster
Sequence 2:NP_957412.2 Gene:ambp / 394093 ZFINID:ZDB-GENE-040426-1608 Length:346 Species:Danio rerio


Alignment Length:44 Identity:16/44 - (36%)
Similarity:25/44 - (56%) Gaps:0/44 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 GTCRSLQPMWTYRPDTNECFTFNYSGCHGNNNLFHKKLECEEKC 77
            |.|::...:|.:...:.:|.:..|.||.||.|.|:.|.||:|.|
Zfish   288 GPCKAFVDLWAFDSSSGKCLSLKYGGCKGNGNRFYSKKECDEYC 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16704NP_608797.1 Kunitz-type 32..77 CDD:444694 15/42 (36%)
ambpNP_957412.2 lipocalin_A1M-like 24..186 CDD:381193
Kunitz_bikunin_1-like 223..276 CDD:438639
Kunitz_bikunin_2-like 278..332 CDD:438640 16/44 (36%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.