DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16704 and K12G11.6

DIOPT Version :10

Sequence 1:NP_608797.1 Gene:CG16704 / 33589 FlyBaseID:FBgn0031558 Length:79 Species:Drosophila melanogaster
Sequence 2:NP_001024057.2 Gene:K12G11.6 / 3565780 WormBaseID:WBGene00010792 Length:186 Species:Caenorhabditis elegans


Alignment Length:72 Identity:20/72 - (27%)
Similarity:27/72 - (37%) Gaps:7/72 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LICCLVASAFATLKNPICGEEFGVKGTCRSLQPMWTYRPD--TNECFTFNYSGCHGNNNLFHKKL 71
            ::.||.:.:.:....|..|..     .|...|....|..|  ...|..|.||||.||.|.|....
 Worm     9 IVLCLFSLSHSCQDPPNRGHT-----KCGKAQKSIKYYFDKKLEMCLPFLYSGCGGNTNRFDDSE 68

  Fly    72 ECEEKCK 78
            .|..:|:
 Worm    69 MCNLRCR 75

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16704NP_608797.1 Kunitz-type 32..77 CDD:444694 15/46 (33%)
K12G11.6NP_001024057.2 KU 20..74 CDD:197529 17/58 (29%)

Return to query results.
Submit another query.