DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16704 and IM33

DIOPT Version :10

Sequence 1:NP_608797.1 Gene:CG16704 / 33589 FlyBaseID:FBgn0031558 Length:79 Species:Drosophila melanogaster
Sequence 2:NP_608800.1 Gene:IM33 / 33592 FlyBaseID:FBgn0031561 Length:82 Species:Drosophila melanogaster


Alignment Length:82 Identity:35/82 - (42%)
Similarity:46/82 - (56%) Gaps:5/82 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKYLVVFALICCLVASAFATLKNPICGEEFGVKGT----CRSLQPMWTYRPDTNECFTFNYSGCH 61
            ||::....|:..|||.|.. ||:||||...|:.|.    |.:..|.::|.|:||.|..|.|.||.
  Fly     1 MKFIAAVCLMFALVAVALG-LKDPICGLPAGIDGNGLIKCAAFIPSFSYHPETNSCEKFIYGGCG 64

  Fly    62 GNNNLFHKKLECEEKCK 78
            ||.|.|..:..||:|||
  Fly    65 GNENRFGTQELCEQKCK 81

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16704NP_608797.1 Kunitz-type 32..77 CDD:444694 18/48 (38%)
IM33NP_608800.1 Kunitz_SCI-I-like 24..80 CDD:438677 22/55 (40%)

Return to query results.
Submit another query.