DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16704 and Acp24A4

DIOPT Version :10

Sequence 1:NP_608797.1 Gene:CG16704 / 33589 FlyBaseID:FBgn0031558 Length:79 Species:Drosophila melanogaster
Sequence 2:NP_001036330.1 Gene:Acp24A4 / 318936 FlyBaseID:FBgn0051779 Length:78 Species:Drosophila melanogaster


Alignment Length:77 Identity:31/77 - (40%)
Similarity:40/77 - (51%) Gaps:1/77 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKYLVVFALICCLVASAFATLKNPICGEEFGVKGTCRSLQPMWTYRPDTNECFTFNYSGCHGNNN 65
            ||.|::..:...|.:::.| |||.|||......|.|.:|...|:|....|.||.|.|.||.||.|
  Fly     1 MKLLILLFVFIALASNSLA-LKNEICGLPAAANGNCLALFSRWSYDAQYNVCFNFIYGGCQGNEN 64

  Fly    66 LFHKKLECEEKC 77
            .|..:.||..||
  Fly    65 SFESQEECINKC 76

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16704NP_608797.1 Kunitz-type 32..77 CDD:444694 18/44 (41%)
Acp24A4NP_001036330.1 Kunitz-type 25..76 CDD:438633 20/50 (40%)

Return to query results.
Submit another query.