DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16704 and CG31609

DIOPT Version :10

Sequence 1:NP_608797.1 Gene:CG16704 / 33589 FlyBaseID:FBgn0031558 Length:79 Species:Drosophila melanogaster
Sequence 2:NP_723444.2 Gene:CG31609 / 318845 FlyBaseID:FBgn0051609 Length:123 Species:Drosophila melanogaster


Alignment Length:77 Identity:26/77 - (33%)
Similarity:36/77 - (46%) Gaps:2/77 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 YLVVFALICCLVASAFATLKNPICGEEFGVKGTCRSLQPMWTYRPDTNECFTFNYSGCHGNNNLF 67
            :|:....:..:|...| |:|.|.|. .....|.|.....:|.|...||.|..|.|.||.||.|.|
  Fly     9 FLLFLYPVVAVVPQGF-TIKQPKCW-YVANPGPCDDFVKVWGYDYLTNRCIFFYYGGCGGNPNRF 71

  Fly    68 HKKLECEEKCKI 79
            :.|.||.:.|::
  Fly    72 YTKEECLKTCRV 83

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16704NP_608797.1 Kunitz-type 32..77 CDD:444694 18/44 (41%)
CG31609NP_723444.2 Kunitz-type 31..81 CDD:444694 19/50 (38%)

Return to query results.
Submit another query.