DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16704 and Col28a1

DIOPT Version :10

Sequence 1:NP_608797.1 Gene:CG16704 / 33589 FlyBaseID:FBgn0031558 Length:79 Species:Drosophila melanogaster
Sequence 2:NP_001418648.1 Gene:Col28a1 / 312115 RGDID:1564680 Length:1141 Species:Rattus norvegicus


Alignment Length:65 Identity:25/65 - (38%)
Similarity:33/65 - (50%) Gaps:1/65 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LVASAFATLKNPICGEEFGVKGTCRSLQPMWTYRPDTNECFTFNYSGCHGNNNLFHKKLECEEKC 77
            |:.|..:..|:|.| ||....|.|......|.|....|.|..|.:|||:|:.|.||.:.||:|.|
  Rat  1075 LLQSEKSLYKDPRC-EEALKPGNCGDYVVRWYYDKQVNSCARFWFSGCNGSGNRFHSEKECQETC 1138

  Fly    78  77
              Rat  1139  1138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16704NP_608797.1 Kunitz-type 32..77 CDD:444694 17/44 (39%)
Col28a1NP_001418648.1 vWFA_subfamily_ECM 47..212 CDD:238727
gly_rich_SclB <257..446 CDD:468478
gly_rich_SclB <363..632 CDD:468478
Collagen 713..772 CDD:460189
VWA 798..974 CDD:459670
Kunitz-type 1088..1138 CDD:444694 20/50 (40%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.