| Sequence 1: | NP_608797.1 | Gene: | CG16704 / 33589 | FlyBaseID: | FBgn0031558 | Length: | 79 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_008760202.1 | Gene: | Tfpi / 29436 | RGDID: | 61914 | Length: | 306 | Species: | Rattus norvegicus |
| Alignment Length: | 45 | Identity: | 19/45 - (42%) |
|---|---|---|---|
| Similarity: | 26/45 - (57%) | Gaps: | 0/45 - (0%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 34 GTCRSLQPMWTYRPDTNECFTFNYSGCHGNNNLFHKKLECEEKCK 78 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG16704 | NP_608797.1 | Kunitz-type | 32..77 | CDD:444694 | 17/42 (40%) |
| Tfpi | XP_008760202.1 | Kunitz_TFPI1_1-like | 50..104 | CDD:438656 | |
| Kunitz_TFPI1_2-like | 120..175 | CDD:438657 | |||
| Kunitz_TFPI1_TFPI2_3-like | 223..276 | CDD:438658 | 17/42 (40%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||