DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16704 and Spint2

DIOPT Version :10

Sequence 1:NP_608797.1 Gene:CG16704 / 33589 FlyBaseID:FBgn0031558 Length:79 Species:Drosophila melanogaster
Sequence 2:NP_001076018.1 Gene:Spint2 / 292770 RGDID:735123 Length:250 Species:Rattus norvegicus


Alignment Length:76 Identity:28/76 - (36%)
Similarity:36/76 - (47%) Gaps:4/76 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VFALICCLVAS-AFATLKNPICGEEFGVK---GTCRSLQPMWTYRPDTNECFTFNYSGCHGNNNL 66
            :.||:..|:.| |.|..::....|..||.   |.||:..|.|.|......|..|.|.||.||.|.
  Rat    13 LLALLASLLLSGAQAASRDLDVHESCGVSKVVGKCRASIPRWWYNVTDGTCQPFVYGGCEGNGNN 77

  Fly    67 FHKKLECEEKC 77
            :..|.||.:||
  Rat    78 YPSKEECLDKC 88

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16704NP_608797.1 Kunitz-type 32..77 CDD:444694 18/47 (38%)
Spint2NP_001076018.1 Kunitz_HAI2_1-like 36..88 CDD:438664 20/51 (39%)
Kunitz_HAI2_2-like 129..181 CDD:438665
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.