DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16704 and Wfdc6a

DIOPT Version :10

Sequence 1:NP_608797.1 Gene:CG16704 / 33589 FlyBaseID:FBgn0031558 Length:79 Species:Drosophila melanogaster
Sequence 2:XP_011237710.1 Gene:Wfdc6a / 209351 MGIID:2684968 Length:193 Species:Mus musculus


Alignment Length:72 Identity:23/72 - (31%)
Similarity:32/72 - (44%) Gaps:7/72 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 CCLVA--SAFATLKNPICG--EEFGVKGTCRSLQPMWTYRPDTNECFTFNYSGCHGNNNLFHKKL 71
            |||.:  .....|:..:|.  ::   .|.|.:..|.|.|..:|:.|..|.|.||.||.|.|..:.
Mouse   117 CCLFSCGKKCMDLRQDVCSLPQD---PGPCLAYLPRWWYNQETDLCTEFIYGGCQGNPNNFPSEG 178

  Fly    72 ECEEKCK 78
            .|...||
Mouse   179 ICTVVCK 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16704NP_608797.1 Kunitz-type 32..77 CDD:444694 16/44 (36%)
Wfdc6aXP_011237710.1 WAP 89..128 CDD:459672 3/10 (30%)
Kunitz_eppin 132..188 CDD:438654 19/57 (33%)

Return to query results.
Submit another query.