| Sequence 1: | NP_608797.1 | Gene: | CG16704 / 33589 | FlyBaseID: | FBgn0031558 | Length: | 79 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001256133.1 | Gene: | ZK287.4 / 191282 | WormBaseID: | WBGene00013965 | Length: | 1285 | Species: | Caenorhabditis elegans |
| Alignment Length: | 38 | Identity: | 17/38 - (44%) |
|---|---|---|---|
| Similarity: | 19/38 - (50%) | Gaps: | 0/38 - (0%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 42 MWTYRPDTNECFTFNYSGCHGNNNLFHKKLECEEKCKI 79 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG16704 | NP_608797.1 | Kunitz-type | 32..77 | CDD:444694 | 15/34 (44%) |
| ZK287.4 | NP_001256133.1 | Lustrin_cystein | 45..91 | CDD:464222 | |
| Kunitz_BPTI | 99..151 | CDD:425421 | |||
| Kunitz_conkunitzin | 257..308 | CDD:438636 | 15/34 (44%) | ||
| KU | 318..368 | CDD:197529 | |||
| Kunitz_conkunitzin | 846..896 | CDD:438636 | |||
| Kunitz_conkunitzin | 995..1043 | CDD:438636 | |||
| Kunitz_conkunitzin | 1054..1104 | CDD:438636 | |||
| Lustrin_cystein | 1148..1189 | CDD:464222 | |||
| KU | <1215..1259 | CDD:197529 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||