DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16704 and K11D12.6

DIOPT Version :10

Sequence 1:NP_608797.1 Gene:CG16704 / 33589 FlyBaseID:FBgn0031558 Length:79 Species:Drosophila melanogaster
Sequence 2:NP_504350.1 Gene:K11D12.6 / 187293 WormBaseID:WBGene00019646 Length:186 Species:Caenorhabditis elegans


Alignment Length:72 Identity:20/72 - (27%)
Similarity:30/72 - (41%) Gaps:3/72 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LICCLVASAF-ATLKNPICGE--EFGVKGTCRSLQPMWTYRPDTNECFTFNYSGCHGNNNLFHKK 70
            :|..|:...| |::...||..  :.|......:....:.|.|....|..|.|:||.||.|.|...
 Worm     1 MILLLLPFLFGASVSQNICDSPVDLGTAKCSNTSSIRYHYDPTVKRCLPFGYTGCGGNENNFADP 65

  Fly    71 LECEEKC 77
            ..|.::|
 Worm    66 RICRQRC 72

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16704NP_608797.1 Kunitz-type 32..77 CDD:444694 12/44 (27%)
K11D12.6NP_504350.1 Kunitz_BPTI 18..72 CDD:425421 15/53 (28%)

Return to query results.
Submit another query.