DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16704 and K01C8.2

DIOPT Version :10

Sequence 1:NP_608797.1 Gene:CG16704 / 33589 FlyBaseID:FBgn0031558 Length:79 Species:Drosophila melanogaster
Sequence 2:NP_495742.1 Gene:K01C8.2 / 186839 WormBaseID:WBGene00010457 Length:389 Species:Caenorhabditis elegans


Alignment Length:62 Identity:19/62 - (30%)
Similarity:28/62 - (45%) Gaps:15/62 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VFALICCLVASAFATLKNPIC--GEEFGVKGTCRSLQPMWTYRPDTNECFTFNYSGCHGNNN 65
            |...:||.:||:.      ||  |:...|.|..:...|. ||    ::| .:||| |..:.|
 Worm   331 VSQFLCCRLASSL------ICINGKTLLVNGAPKLCTPT-TY----SQC-PYNYS-CQQSVN 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16704NP_608797.1 Kunitz-type 32..77 CDD:444694 11/34 (32%)
K01C8.2NP_495742.1 Lustrin_cystein 137..174 CDD:464222
Lustrin_cystein 235..280 CDD:464222
Lustrin_cystein 292..337 CDD:464222 1/5 (20%)
Lustrin_cystein 345..387 CDD:464222 13/42 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.