DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16704 and piit-1

DIOPT Version :10

Sequence 1:NP_608797.1 Gene:CG16704 / 33589 FlyBaseID:FBgn0031558 Length:79 Species:Drosophila melanogaster
Sequence 2:NP_505943.2 Gene:piit-1 / 185259 WormBaseID:WBGene00009384 Length:200 Species:Caenorhabditis elegans


Alignment Length:72 Identity:23/72 - (31%)
Similarity:29/72 - (40%) Gaps:2/72 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ALICCLVASAFATLKNPICGEEFGVKGTC--RSLQPMWTYRPDTNECFTFNYSGCHGNNNLFHKK 70
            |:|..|::...|...:..|........||  .|...|:.|.|....|..|.|.||.||:|.|...
 Worm     6 AVILSLLSFTAAQSTSVDCFAARDSGNTCAENSSSRMFYYLPRLGTCQPFMYQGCGGNSNRFSSA 70

  Fly    71 LECEEKC 77
            .||...|
 Worm    71 QECRSAC 77

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16704NP_608797.1 Kunitz-type 32..77 CDD:444694 17/46 (37%)
piit-1NP_505943.2 Kunitz_BPTI 24..77 CDD:425421 18/52 (35%)
KU 137..192 CDD:197529
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.