DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16704 and C54D10.10

DIOPT Version :10

Sequence 1:NP_608797.1 Gene:CG16704 / 33589 FlyBaseID:FBgn0031558 Length:79 Species:Drosophila melanogaster
Sequence 2:NP_506123.2 Gene:C54D10.10 / 183787 WormBaseID:WBGene00008304 Length:216 Species:Caenorhabditis elegans


Alignment Length:79 Identity:22/79 - (27%)
Similarity:38/79 - (48%) Gaps:7/79 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKYLVVFALICCLVASAFATLKNPICGEE--FGVKGTCRSLQPMWTYRPDTNECFTFNYSGCHGN 63
            |:::.:|.|:||:  |:.:.:.   |.:|  .||....:.:...:.:...||.|....|.||.||
 Worm     1 MQFISIFLLLCCI--SSVSAIN---CRQEKDTGVNCDNKPITLKFYFDMRTNVCQPLFYRGCGGN 60

  Fly    64 NNLFHKKLECEEKC 77
            .|.|..:..|.:.|
 Worm    61 ENRFESRDACSDAC 74

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16704NP_608797.1 Kunitz-type 32..77 CDD:444694 12/44 (27%)
C54D10.10NP_506123.2 Kunitz_BPTI 21..75 CDD:425421 16/54 (30%)
KU 158..213 CDD:197529
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.