DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16704 and B0222.5

DIOPT Version :10

Sequence 1:NP_608797.1 Gene:CG16704 / 33589 FlyBaseID:FBgn0031558 Length:79 Species:Drosophila melanogaster
Sequence 2:NP_505373.1 Gene:B0222.5 / 181860 WormBaseID:WBGene00015056 Length:369 Species:Caenorhabditis elegans


Alignment Length:56 Identity:18/56 - (32%)
Similarity:22/56 - (39%) Gaps:2/56 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 PICGEEFGVKGTCRSLQPMWTYRPD--TNECFTFNYSGCHGNNNLFHKKLECEEKC 77
            |.|........||...:....|..|  |.:||.|.:.||.||.|.:....||...|
 Worm   186 PWCASNRNAGHTCNQNKTSIRYWFDVETFQCFPFEHKGCGGNQNSYRTSSECYFDC 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16704NP_608797.1 Kunitz-type 32..77 CDD:444694 15/46 (33%)
B0222.5NP_505373.1 TY 22..84 CDD:238114
TY 87..154 CDD:238114
KU 186..241 CDD:197529 17/54 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.