DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16704 and E01G6.1

DIOPT Version :10

Sequence 1:NP_608797.1 Gene:CG16704 / 33589 FlyBaseID:FBgn0031558 Length:79 Species:Drosophila melanogaster
Sequence 2:NP_510044.2 Gene:E01G6.1 / 181387 WormBaseID:WBGene00008449 Length:1467 Species:Caenorhabditis elegans


Alignment Length:66 Identity:23/66 - (34%)
Similarity:30/66 - (45%) Gaps:4/66 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 CLVASAFATLKNPICGEEFGVKGTCRSLQPMWTYRPDTNECFTFNYSGCHGNNNLFHKKLECEEK 76
            |..:|..|...|...|.  |.||:.:  :.||.|.....:|..|.|:||.|..|.|..|:.|.|.
 Worm   534 CCPSSENACNANMSRGN--GCKGSTQ--RSMWFYDKSKKKCSQFVYNGCGGTPNRFTTKVACTES 594

  Fly    77 C 77
            |
 Worm   595 C 595

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16704NP_608797.1 Kunitz-type 32..77 CDD:444694 16/44 (36%)
E01G6.1NP_510044.2 WR1 289..325 CDD:214601
Kunitz_BPTI 330..386 CDD:425421
Kunitz_BPTI 437..492 CDD:425421
Kunitz_BPTI 541..596 CDD:425421 21/59 (36%)
Lustrin_cystein 604..648 CDD:464222
Lustrin_cystein 859..902 CDD:464222
Lustrin_cystein 909..951 CDD:464222
Lustrin_cystein 1197..1239 CDD:464222
EB 1265..1321 CDD:460294
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.